SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337281830|ref|YP_004621301.1| from Streptococcus parasanguinis ATCC 15912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337281830|ref|YP_004621301.1|
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.11e-30
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337281830|ref|YP_004621301.1|
Sequence length 106
Comment PTS family cellobiose porter component IIA [Streptococcus parasanguinis ATCC 15912]
Sequence
MDEKVLEVCFQIITYVGTAKSMYIDAIQLARQGEFEQAKDRIKQGEEAYVQGHNAHHSLL
TKEMNGELSQTGLLLMHAEDQLMSAEGFRTIAEEFIAVYKRFEEGK
Download sequence
Identical sequences A0A1F0KAD1 F8DIS7
gi|337281830|ref|YP_004621301.1| WP_013903427.1.38058 WP_013903427.1.91044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]