SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337282177|ref|YP_004621648.1| from Streptococcus parasanguinis ATCC 15912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337282177|ref|YP_004621648.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.55e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|337282177|ref|YP_004621648.1|
Sequence length 105
Comment PTS family lactose porter IIA component [Streptococcus parasanguinis ATCC 15912]
Sequence
MNKEEVQLLGFEIVAYAGDARSKLMEALKAAENGDFAKAESLVEEAGSCIAEAHKSQTTM
LAQEAAGEEIPYCITMMHGQDHLMTTILLKDVIHHLIELYKRGAK
Download sequence
Identical sequences A0A2I1TTP0 F8DI13 I1ZMG3
gi|387879751|ref|YP_006310054.1| WP_013903726.1.15754 WP_013903726.1.25520 WP_013903726.1.38058 WP_013903726.1.47749 WP_013903726.1.97022 gi|337282177|ref|YP_004621648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]