SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337282828|ref|YP_004622299.1| from Streptococcus parasanguinis ATCC 15912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337282828|ref|YP_004622299.1|
Domain Number 1 Region: 6-448
Classification Level Classification E-value
Superfamily SIS domain 5.29e-135
Family Phosphoglucose isomerase, PGI 0.000000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337282828|ref|YP_004622299.1|
Sequence length 449
Comment glucose-6-phosphate isomerase [Streptococcus parasanguinis ATCC 15912]
Sequence
MSHIKFDYSKVLGKFVAPHEVEYMQPQVTAADELIRKGTGAGSDFLGWLDLPENYDREEF
DRILKAAEQIKADSDVLVVIGIGGSYLGAKAAIDFLNHHFANLQTKEERKAPQILYAGNS
ISSTYLADLVEYVSDKDFSVNVISKSGTTTEPAIAFRVFKELLVKKYGQEEANKRIYATT
DRAKGAVKVEADANGWETFVVPDDIGGRFSVLTPVGLLPIAASGADIKALMEGANAARKE
YTSDKLSENEAYQYAAVRNILYRKGYATEILVNYEPSLQYFSEWWKQLAGESEGKDQKGI
YPTSANFSTDLHSLGQFIQEGTRIMFETVVRVDKPRKNVIIPTLEEDLDGLGYLQGKDVD
FVNKKATDGVLLAHTDGDVPNMYVTLPEQDAFTLGYAIYFFELAIALSGYLNAINPFDQP
GVEAYKKNMFALLGKPGFEELGAELNARL
Download sequence
Identical sequences E3CBW5 F8DJQ4 I2NLH2 T0V8Z7
gi|337282828|ref|YP_004622299.1| WP_003002120.1.25520 WP_003002120.1.38058 WP_003002120.1.64844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]