SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337283010|ref|YP_004622481.1| from Streptococcus parasanguinis ATCC 15912

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337283010|ref|YP_004622481.1|
Domain Number 1 Region: 17-377
Classification Level Classification E-value
Superfamily SIS domain 2.11e-51
Family double-SIS domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337283010|ref|YP_004622481.1|
Sequence length 389
Comment sugar isomerase domain-containing protein AgaS [Streptococcus parasanguinis ATCC 15912]
Sequence
MLDYTKEDLQELGAEITSREIYQQPSVWKETARLYQERKAEIKAFLEKIGQEYDYIKVIL
TGAGTSAYVGDTLVPYLQEVHDERHWNFQSIATTDIVAHPQTYLKKEVPTVLVSFARSGN
SPESVATVQLAQDLVDELYQITITCAEEGKLAQQAHGDERNLLFLQPKETNDAGFAMTSS
FTSMLLTALLVFDPSEEEIKENRVSELVHLSEQILEKDREVKEVVDLDFERVIYLGAGPF
FGLAHEAQLKILELTAGKIATMYESPVGFRHGPKSLINDQTLVLVFGSIDPYTRQYDLDL
VREVAGDQIARQVVLLTDQVAGIEHVREVLVEASADSLDIYRAFPYIIYGQLISLLTSLK
VQNRPDTPSPTGTVNRVVQGVIIHSFHKE
Download sequence
Identical sequences F8DG74
WP_013904402.1.38058 gi|337283010|ref|YP_004622481.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]