SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330444167|ref|YP_004377153.1| from Chlamydophila pecorum E58

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330444167|ref|YP_004377153.1|
Domain Number 1 Region: 211-398
Classification Level Classification E-value
Superfamily PheT/TilS domain 3.92e-49
Family B3/B4 domain of PheRS, PheT 0.00016
Further Details:      
 
Domain Number 2 Region: 40-196
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.08e-33
Family Myf domain 0.0022
Further Details:      
 
Domain Number 3 Region: 480-681
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.34e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0003
Further Details:      
 
Domain Number 4 Region: 691-784
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.28e-19
Family Anticodon-binding domain of PheRS 0.0015
Further Details:      
 
Domain Number 5 Region: 406-473
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000011
Family Domains B1 and B5 of PheRS-beta, PheT 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330444167|ref|YP_004377153.1|
Sequence length 792
Comment phenylalanyl-tRNA synthetase subunit beta [Chlamydophila pecorum E58]
Sequence
MHVPLSLLQTYFSAPLRIKDLLSACDRIGIEAEVHIETSASFSSVITAKILQVCPHPNAD
KLKVATLFDGSQEYQIVCGAPNCREGIVVPLALPGAKLTDSQGNVLTIKKSKIRGVESQG
MCCGADELGLPEELVTHGLLELANDTPLGEDVATIFSETILEISLTPNLGHCASLFGLAR
EISHVTSAALTLPKEFSLQPMPLQEVPSRNDFSVCPLFCYIKISGIPPASPSPAHLQNAL
RSLKQKSVNALVDVTNYLMFSLGQPLHAYDARSVHVGSLHVQYTESACSLTLLNNETVML
PKQVPVVCDDERILALAGVMGSLESAVSDETTEIILEGAYFPSEVLRASQNLVPIHSEAS
YRFSRGVDYNNVVPAFFAAIHYLKKMFPEAEFSPIYVMGEAQRTQKTLLLRASTVERILG
ETLTTKTIHAKLSSLGFPIREETAKHLRVEIPSYRHDIQREIDLVEEVFRTQSWHVEARK
PTPCYTSIYKLKRHLVDLLANSGLQQFFTCDLLKPELAALCDAEHLITLQGSKHATALRP
SLLPGLLESTATNLNRQAGGVYAFELGAVYKKVASQYQETQTLSILLSGQAEAPSWLPSQ
GPLSFFSIKSWIEKILNHLGISSQAYTLEPSNHAYFHPYQQGLLRLHKHTLGILGTVHPK
LTKKMQIKHPVFFGELSVDLLNQGQKKTSSQYVPYPIYPSSFRDVTLAVPEELPADALRK
ELLRSPSKWLERVSIISIYQNKASSNQEKHVSLRLVFQDRKRTLSNQEIDEEYERLVSGL
TQRLKDKGMILT
Download sequence
Identical sequences WP_013712528.1.43372 WP_013712528.1.9625 gi|330444167|ref|YP_004377153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]