SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326789589|ref|YP_004307410.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326789589|ref|YP_004307410.1|
Domain Number 1 Region: 9-59,204-429
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.66e-36
Family FolH catalytic domain-like 0.052
Further Details:      
 
Domain Number 2 Region: 92-200
Classification Level Classification E-value
Superfamily PA domain 0.00000000497
Family PA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326789589|ref|YP_004307410.1|
Sequence length 678
Comment peptidase M28 [Clostridium lentocellum DSM 5427]
Sequence
MRDKVEKYIDIHYAYEFAKKLETYKCNTKLGFRTAGSRAEILTGQLIYKEMQQIGLEHIT
KDEITVDSWEFQKAQLSFEDLDGQSYQFELGAYQTQFQTEGPQKFSMVYLEKGTAEDYKG
VDVKGKLVLVDINQRDEWWINFPVYEAYLKGAAALIAVQASGYGEIDQTALNAQDIAGPS
EAVAFSISQRDAYYLKEALKVRSEIEVTFDAISIVKPNQKTYNIVGKIQGTDSDAMILLS
AHYDSYFEGFQDDNVAVAMILGIAKAIKQSGYRPKRTLVFTAMAAEEWGLINSKYDWSTG
AYEEVFHVHPDWKGKVIADLNFELPAHAHGKKDKVRCVYEYAEFIDAFIKEIRVPEEAYP
EGIEVIYPIETWSDDFSIAIAGIPSMVNDFSSGSFMETHYHSQFDNKDFYNEAVYTFHHK
FYTKLVMALDQTAVVPLNFMRLFEEMGRSLCSIDQSLMDIKAINNLLNQLKGLSKQLYAY
VQRVNKQYLTYLMQENTEKAAEIYRDYRWLEKQLLAGFAREQDELVRLNWHDEVYFPHEI
IIKNLQCIKKAILALEEKEIIEALSSIYQIDNNKYAFLFEKQVYEYFTDYVLCQPIDRVK
WGAGRIIGHEDLFDIVHSLKAKIKIRQPNVENEIRQLEEVYERQQNLLDDILKDEKFFLE
TFYSYMEEMLNKLDRDRL
Download sequence
Identical sequences F2JLC4
WP_013655513.1.79355 gi|326789589|ref|YP_004307410.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]