SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326790183|ref|YP_004308004.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326790183|ref|YP_004308004.1|
Domain Number 1 Region: 56-147
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.01e-25
Family Ribosomal protein L9 C-domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 4.01e-17
Family Ribosomal protein L9 N-domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326790183|ref|YP_004308004.1|
Sequence length 148
Comment 50S ribosomal protein L9 [Clostridium lentocellum DSM 5427]
Sequence
MKVILTQDVKKVGKKGEVLEVKDGYARNALFPKGLAVEANAVNLNQRMLEQKSEDKRKQQ
ELDEAQAIADKINDKEVKLLVKTGEGGKVFGSVTSKEIAETIEKEFGVKIDKKKIQLKEA
IKGLGGQKVVIKLHAKVVATVQVMVVGA
Download sequence
Identical sequences F2JRZ2
gi|326790183|ref|YP_004308004.1| WP_013656105.1.79355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]