SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326790883|ref|YP_004308704.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326790883|ref|YP_004308704.1|
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily L28p-like 1.12e-18
Family Ribosomal protein L28 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326790883|ref|YP_004308704.1|
Sequence length 61
Comment 50S ribosomal protein L28 [Clostridium lentocellum DSM 5427]
Sequence
MAKCEICSKDVHFGIKVSHSHRRSNKMWKSNVRKVRVNQNGAVKTMNVCTRCLRSNLVAR
A
Download sequence
Identical sequences F2JMI8
gi|326790883|ref|YP_004308704.1| WP_013656803.1.79355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]