SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326791519|ref|YP_004309340.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326791519|ref|YP_004309340.1|
Domain Number 1 Region: 15-208
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-52
Family Methylesterase CheB, C-terminal domain 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326791519|ref|YP_004309340.1|
Sequence length 211
Comment chemotaxis protein CheB [Clostridium lentocellum DSM 5427]
Sequence
MSQISRNAATIEEQQYEYIIAMGISTGGPKLLSQIIPTLEQNLSATYLIVQHMPQGFTKN
LAARLNSLSALEVKEAEHEEVLKRGTVYIAPGGKQLKIINGLRPQINITDDLPYKGHKPS
VNIMMSSLAELKSCSKKMIAVIMTGMGSDGLEGVSDLKRTYPCEVIAQDQASSTVYGMPK
AIANAGLADYIASAENITQIIKRIVGDNHGR
Download sequence
Identical sequences F2JGQ0
gi|326791519|ref|YP_004309340.1| WP_013657435.1.79355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]