SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326791766|ref|YP_004309587.1| from Clostridium lentocellum DSM 5427

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326791766|ref|YP_004309587.1|
Domain Number 1 Region: 6-70
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000358
Family GntR-like transcriptional regulators 0.035
Further Details:      
 
Domain Number 2 Region: 90-215
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.000000000000288
Family GntR ligand-binding domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326791766|ref|YP_004309587.1|
Sequence length 220
Comment GntR family transcriptional regulator [Clostridium lentocellum DSM 5427]
Sequence
MENKEYFKVIEYIKEQMKNGTIQIGGKLETERKLSEKLGISRPSIREALRSMENIGLIES
KQGSGNYLLGNFSKNLTESFSLMLLMKQVDYVDITEVRRAIELEAYKIAMRSISDQQLKD
IKSCLVNPLNERFENEILFDKNFHFSIVKATGNGFMMNIVEPLASVCEELIEETLKKATI
DEREQLAQYHMQIYLGLEEKNLEKGLSAINAHYDLINQLQ
Download sequence
Identical sequences F2JJ96
gi|326791766|ref|YP_004309587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]