SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333996005|ref|YP_004528618.1| from Treponema azotonutricium ZAS-9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333996005|ref|YP_004528618.1|
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily AF1862-like 7.85e-23
Family Cas Cmr5-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333996005|ref|YP_004528618.1|
Sequence length 124
Comment crispr-associated protein, Cmr5 family [Treponema azotonutricium ZAS-9]
Sequence
MQTKQQKRAEFALEQIANFGTPVPSKSVSFIVSTPTMLLMNGLGQTLAFLLSRGIDGNEG
KVFNIIKEWLIKEQFVPEAHNLEFLKKFNSLDQAEYLKAQHETLKLLEWLKRYARAFQAI
EGKN
Download sequence
Identical sequences F5YCJ3
gi|333996005|ref|YP_004528618.1| WP_015712721.1.50409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]