SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000047 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000047
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 1.53e-166
Family Phosphoglycerate kinase 0.00000000000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000047   Gene: ENSPANG00000003184   Transcript: ENSPANT00000002993
Sequence length 417
Comment pep:known_by_projection chromosome:PapAnu2.0:4:48970413:48971666:-1 gene:ENSPANG00000003184 transcript:ENSPANT00000002993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLQPVAAELKSLLGKDILFLKDCVGAEVENACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEGFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMTKAQKNGVRITFPVDFVTADKFDENAQVGK
ATVASGIPPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
Download sequence
Identical sequences A0A096MKN1
ENSPANP00000000047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]