SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000151 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000151
Domain Number 1 Region: 6-439
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-125
Family ALDH-like 0.000000000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000151   Gene: ENSPANG00000010862   Transcript: ENSPANT00000009617
Sequence length 468
Comment pep:known_by_projection chromosome:PapAnu2.0:14:6328019:6354414:-1 gene:ENSPANG00000010862 transcript:ENSPANT00000009617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFEDTLRRLREAFHTGRTRSAEFRAAQLRGLGRFLHENKQLLHDALAQDLHKSAFESE
LSEVAISQGEITLALRNLRAWMKDEHVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNL
TLVPLVGALAAGNCVVLKPSEISKSMEKVLAEVLPRYLDESCFAVVLGGPQETGQLLEHR
FDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC
GHVAIGGQSDESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVRSVDEAIEFINRREK
PLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGQYHGKFSFD
TFSHHRACLLRRPGMEKLNALRYPPHSPRRLRVLLVAMEARGCSCTLL
Download sequence
Identical sequences A0A096MKW4 A0A2K5LLA3
ENSPANP00000000151 XP_011896789.1.92194 XP_011896790.1.92194 XP_011896791.1.92194 XP_011896792.1.92194 XP_011896793.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]