SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000188 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000188
Domain Number 1 Region: 136-192
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000183
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 51-93
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000759
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000188   Gene: ENSPANG00000023865   Transcript: ENSPANT00000011345
Sequence length 714
Comment pep:known_by_projection chromosome:PapAnu2.0:6:128124:214125:1 gene:ENSPANG00000023865 transcript:ENSPANT00000011345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRFPVTGCPVSSRPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAE
LDHLASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGVPSPRDSCP
LAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDD
RQDFCRQLHWAMDPPQAVFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFIC
RVRCLLDSTSGFLTMQFQGKLKFLFGQKKKAPSGAVLPPRLSLFCIVAPVLLPSTAEMKM
RSALLRAKPRADTVATTDAKVKATTSLCESEPRGKPNYSAGRSSRESGVLVLREQTDAGR
WAQVPTRAPCLCLRGGPDLVLDPKGCSGDREEEQHKMLSRASGVTGHRETPGPTKPLPWT
AGRHGEDGARPRLQPSKSDPPCLCPTPRGSCLPYSCVQGTFRNSPISHPPSPSPSAYSSR
TSRPVRDVGEDQVHPPLCHFPQGSLQHRLPQPGAQRFATRGYPMEDVKLQGVPMPPGDLC
GPTLLLDVPIKMEKDSGSEDAADGCVPSQGWLGASDRSRPATFPTRMHLKTEPDSRQQVY
ISHLGHGVRGTQPHGRATVGRSRELTPFHPAHCACLEPMHGLAQPEPPHQLCARGRGEQS
CACRAAEAAPVVKREPLDSPQWAAHSQGAVPGMFPKSALATLVPPQASECTFLP
Download sequence
Identical sequences ENSPANP00000000188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]