SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000391 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000000391
Domain Number 1	Region: 227-283
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	9.26e-25
Family	Classic zinc finger, C2H2	0.0022
Further Details:

Domain Number 2	Region: 339-395
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	5.58e-24
Family	Classic zinc finger, C2H2	0.0038
Further Details:

Domain Number 3	Region: 11-70
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	1.11e-23
Family	KRAB domain (Kruppel-associated box)	0.0014
Further Details:

Domain Number 4	Region: 282-339
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.66e-23
Family	Classic zinc finger, C2H2	0.0047
Further Details:

Domain Number 5	Region: 380-432
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.03e-19
Family	Classic zinc finger, C2H2	0.0045
Further Details:

Domain Number 6	Region: 188-240
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.79e-19
Family	Classic zinc finger, C2H2	0.0059
Further Details:

Weak hits

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000000391 Gene: ENSPANG00000009586 Transcript: ENSPANT00000007704
Sequence length	441
Comment	pep:known_by_projection chromosome:PapAnu2.0:19:50244050:50253167:1 gene:ENSPANG00000009586 transcript:ENSPANT00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAAALRDPAQQGYVTFEDVAVYFSQEEWRLLDETQRLLYRNVMLENFSLLASLGLASSK THEITQLESWEEPFMPAWEVMTSALPKGCWHGAEAKEALEQSASVKVPSSNVQQHQKHYG EKPLKRQEGRVPVLRSCRVHLSEKSLQSREVGKDLLTSSGVLKHQMTHTGEKSHRSSKSK EAFHGGKRYYKCSECGKDFGQKYLLVQHQRLHTGEKPYECSECGKLFSHKSNLFIHQIVH TGERPYGCSDCGKSFSRNADLIQHQRVHTGEKPFTCSECGKAFRHNSTLVQHHRIHTGVR PYECSECGKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSSLINHWRVHTGERPYEC SECGKFFSQSSSLMQHRKVHTGEKPFKCNECGRFFSENSSLVKHQRVHTGAKPYECRECG KFFRHSSSLVKHRRIHTGEIQ
Download sequence
Identical sequences	A0A0A0MU00 ENSPANP00000000391

SEARCH