SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000409 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000409
Domain Number 1 Region: 49-545
Classification Level Classification E-value
Superfamily Sema domain 2.49e-101
Family Sema domain 0.002
Further Details:      
 
Domain Number 2 Region: 1410-1535,1701-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-33
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 977-1067
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000572
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 4 Region: 886-977
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000794
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 5 Region: 1064-1145
Classification Level Classification E-value
Superfamily E set domains 0.00000000000513
Family E-set domains of sugar-utilizing enzymes 0.074
Further Details:      
 
Domain Number 6 Region: 548-600
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000101
Family Plexin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000409
Domain Number - Region: 1206-1258
Classification Level Classification E-value
Superfamily E set domains 0.00224
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 
Domain Number - Region: 707-747
Classification Level Classification E-value
Superfamily Plexin repeat 0.0144
Family Plexin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000409   Gene: ENSPANG00000005560   Transcript: ENSPANT00000000651
Sequence length 1969
Comment pep:known_by_projection chromosome:PapAnu2.0:11:83463987:83515857:1 gene:ENSPANG00000005560 transcript:ENSPANT00000000651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGEGGKRKQERARKAKRPSGAGPAPRAAHPLLLLLLLGAARVGALEIQRRFPSPTPTNN
FALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVPDSPLCHAPQLPQASCEHPRRLT
DNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVRFPPAAPPAEPVTVFPSMLN
VAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSSFFPRNRSLEDHRFENTPEIAIR
SLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVSAFLHPPDPPPGAQPYAYLAL
NSEARAGDKESQARSLLARICLPHGAGSDAKKLTESYIQLGLQCAGGAGRGDLYSRLVSV
FPARERLFAVFERPQGSPAARAAPAALCAFRFADVRAAIRAARTACFVEPAPDVVAVLDS
VVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPLKATPVFRAPGLTSVAVASVNN
YTAVFLGTVNGRLLKINLNESMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQM
ARVKVAACNVHSTCGDCVGAADAYCGWCALETRCTLQQDCANSSQHHFWTSASEGPSRCP
AMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACDYGKNIRTVARVPGPAFGHQIAYC
NLLPRDRFPPFPPNQDHVTVEMSVRVNGRNIVKANFTIYDCSRTAQVYPHTACTSCLSAQ
WPCFWCSQQHSCVSNQSRCEASPNPTSPQDCPRTLLSPLAPVPTGGSQNILVPLANTAFF
QGAALECSFGLEEIFEAVWVNESAVRCDQVVLHTTQKSQVFPLSLQLKGRPARFLDSPEP
MTVVVYNCATGSPDCSQCLGREDLGHLCVWSDGCRLRGPLQPMPGTCPAPEIRAIEPLSG
PLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAPGPLSDI
VTVNASKEGKSRDRFSYVLPLVHSLEPPMGPKAGGTRITIHGNDLHVGSELQVLVNDTDP
CTELMRTDTSITCTMPEGALPAPVPVCVRFERRGCVHGNLTFWYMQNPVITAISPRRSPV
SGGRTITVAGERFHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFI
NGRAYADEVAVTEELLDPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHK
EQDSLGLQSHEYRVKIGQVSCDIQIVSDRIIHCSVNESLGAAEGKLPITIQVGNFNQTIA
TLQLGGSETAIVVSIVICSVLLLLSVVGQACHLAPAPLKIGRWRKAGWDGAQLEQRLGHG
NRKGYSXELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNS
QGSSQAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAVRD
RCSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSI
CMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNV
SFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYIL
RDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPT
DELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYF
FDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQ
AFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEE
SRKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQHKFEQVVALMEDNIYE
CYTSSWSCCREPGASRQPSTKKGRGGHQPGGCSPETLPHPHWCREPSLN
Download sequence
Identical sequences ENSPANP00000000409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]