SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000482 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000482
Domain Number 1 Region: 44-153
Classification Level Classification E-value
Superfamily POZ domain 3.14e-28
Family Tetramerization domain of potassium channels 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000482   Gene: ENSPANG00000017025   Transcript: ENSPANT00000011801
Sequence length 321
Comment pep:known_by_projection chromosome:PapAnu2.0:5:39239169:39240287:-1 gene:ENSPANG00000017025 transcript:ENSPANT00000011801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKDTGSGGSTILPISEMVSSSSSPGASAAAAPGPCAPSPFPEVVELNVGGQVYVTKHS
TLLSVPDSTLASMFSPSSPRGGARRRGELPRDSRARFFIDRDGFLFRYVLDYLRDKQLAL
PEHFPEKERLLREAEYFQLTDLVKLLSPKVIKQNSLNDEGCQSDLEDNVSQGSSDALLLR
GAAAAVPSGPGVHGGGGGSGAPDKRSGFLTLGYRGSYTTVRDNQADAKFRRVARIMVCGR
IALAKEVFGDTLNESRDPDRQPEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAA
FVNQYRDDKIWSSYTEYIFFR
Download sequence
Identical sequences ENSPANP00000000482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]