SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000573 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000573
Domain Number 1 Region: 185-285
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.55e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 37-100
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000223
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000573   Gene: ENSPANG00000014598   Transcript: ENSPANT00000022121
Sequence length 606
Comment pep:known_by_projection chromosome:PapAnu2.0:19:39612887:39652380:1 gene:ENSPANG00000014598 transcript:ENSPANT00000022121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKH
LGLSQLELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRG
RTLNLKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPL
GRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSK
GQAVTGQYRFLARNGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQT
EQHSRRPIQRGAPSQKDTPNPGNSLDAPGPRILAFLHPPSLSEAALAADPRRFCSPDLRR
LLGPILDGASVAATPSTPLATRRPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDL
DIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPALE
PSLLPRWGSDPRLSCSSPSRGNPSASSSMAGARKRTLAQSSEDEDEGVELLGVRPPKRSP
SPEPENFLLFPLSLSFLLTGGPAPGRLQDPSTHLLDLNEPLGLGPSLLSPYSDEDTTQPR
DHFQPT
Download sequence
Identical sequences ENSPANP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]