SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000619 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000619
Domain Number 1 Region: 1309-1501,1554-1737,1771-1826
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.56e-112
Family DNA polymerase I 0.000000912
Further Details:      
 
Domain Number 2 Region: 4-78
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 4.45e-16
Family Achaeal helicase C-terminal domain 0.0043
Further Details:      
 
Domain Number 3 Region: 1140-1261
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000986
Family DnaQ-like 3'-5' exonuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000619   Gene: ENSPANG00000000759   Transcript: ENSPANT00000009492
Sequence length 1830
Comment pep:known_by_projection chromosome:PapAnu2.0:2:40873597:40927048:-1 gene:ENSPANG00000000759 transcript:ENSPANT00000009492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVLGMITVFSNRLGWHNMELLLSQFQKRLTFGIQRELCDLVRVSLLNAQRARVLYASGF
HTVADLARANIVEVEVILKSAVPFKSARKAVDEEEEAVEERRNMRTIWVTGRKGLTEREA
AALIVEEARMILQQDLVEMGVQWNPCALLHSSTCSLTHSESEVKEHTFISQTKSSYKKLT
SKNKSNTIFSDSYIKHSPNIVQDLNKSREHTSSFNCNFQDGNQEHQRHSIFRARKWASLD
INKEKPGASQNEGKTSNKKVKTFSEKTKKAPLNFNSEKMSRSFRSWKHRKHLKQSRDSSP
LKDSGACRIHLQGQTLSNPSLCEDPFTLDEKNTEFRNSGPFDKNVSLSGKEKDNKTSFPL
QIKQSCSRNITLTNDNFVEDIVTGSQSKNVTCQATGVVGEKGRGVAVEAEKINEVLIQND
SKNQNVYVKHCDTDPINQYPQKQSHEQTSTFTKQKNIIERQMPCEAVSSYINRDSNVTIN
CERIKLDTEENKPSHFQALGDDISRTAIPSEVLPSTGAFSKSGGQHENFLNISRLQEKTG
TYTTNKTKNNHISDCDFEDSFYLDTQSEKIMQQMATENTKLGAKDTNLAAGIMQKSVVQQ
NLMNSFQKECHVPFPAKQHPLGVTKIDHLDLKTVGTMKQSTDSHGVDILTPESPIFHSPI
LLEENGLCFKKNELSVTDSQLNSFLQGYQTQETVKPVIPLIPQKRTPTGIEGECLPVPET
SLNMSDSLLFDSFSDDYLVKEQLPDVQTKEPLPSEVTSHHFSDSLCLQQEDLIKKSNVNE
NQDTCQQLTFSNDESVIFSEMDSVQMVEALDNADILPVQEKHHTVVYPRALELNDPVLDE
HHQGDQDGGDQDERAEKSKLTGTRQNHSFIWSGASFDLSPGLQRILDKVSSPLENENLKS
VTINLSSLNGKNTELNEEQEVISNLETNQVQGISFSSNSEVKSKIEMLENNANHGETSSL
LPRKESDIVDDNGLIPPTPVPTSASKLTFPGILETPVNCWKTNNVLQPGESYLFDSPSDI
KNHDLSPESRNGFKDNNPISDTGFSLQLSQDGLQLTPASSSSESLAIIDVASDQNLFQTF
IKEWRCKKRFSISLACEKIRSFTSSKTATIGGRFKQASSPQEIPIRDDGFPIKGCDDILV
VGLAVCWGGRDAYYFSLQKEQKHSEISASLVPPSLDPSLTLKDRIWHLQSCLRKESDKEC
SVVIYDFIQSYKILLLSCGISLEQSYEDPKVACWLLDPDSQEPTLHSIVTSFLPHELPLL
EGMETSQGIQSLGLNAGSEHSGRYRASVESILIFNSMNQLNSLLQKENLQDVFHKVEMPS
QYCLALLELNGIGFSTAECESQKHIMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLE
LKLPPNGEMKNQGSKKTLGSTRRGNDNGRKLRLGRQFSTSKDVLNKLKALHPLPGLILEW
RRITNAITKVVFPLQREKRLNPFLGMERIYPVSQSHTATGRITFTEPNIQNVPRDFEIKM
PTLVGESPPSQAIGKGLLPMGRGKSKKGCSLNPGRQAQMEERAADRGMPFSISMRHAFVP
FPGGLILAADYSQLELRILAHLSHDRRLIQVLNTGADVFRSIAAEWKMIEPQSVGDDLRQ
QAKQICYGIIYGMGAKSLGEQMGIKENDAACYIDSFKSRYTGINQFMRETVKNCKRDGFV
QTILGRRRYLPGIKDNNPYHKAHAERQAVNTTVQGSAADIVKIATVNIQKQLETFHSTFK
SHGHREGMLRSDRTGLLRKRKLQGMFCPVRGGFFILQLHDELLYEVAEEDVVQVAQIVKN
EMESAVKLSVKLKVKVKIGASWGELKDFDV
Download sequence
Identical sequences ENSPANP00000000619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]