SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000676 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000676
Domain Number 1 Region: 153-255,423-494
Classification Level Classification E-value
Superfamily TrmE connector domain 2.22e-41
Family TrmE connector domain 0.0041
Further Details:      
 
Domain Number 2 Region: 104-184,223-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-36
Family G proteins 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000676   Gene: ENSPANG00000017711   Transcript: ENSPANT00000013536
Sequence length 494
Comment pep:known_by_projection chromosome:PapAnu2.0:19:15882202:15886488:1 gene:ENSPANG00000017711 transcript:ENSPANT00000013536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLAAQAARGPRRLCTRRSSGAAAPGSGATIFALSSGQGRCGIAVIRTSGPSSGH
ALRILTAARDLPPARHASLRLLSDPCSGEPLDRALVLWFPGPRSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGILEQATADIEVRALEVALGAHLR
DARRGQRLRSGAHVVVTGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLETPVDLAGFP
VLLSDTAGLREGVGPVEQEGVRRARERLEQADLILAMLDASDLASPSSCNFLATVVASVG
ARSPSDSSQRLLLVLNKSDLLSPEGPGPRPDLPPHLLLSCLTGEGLDGLLEALRKELAAV
CGDPSTGSPLLTRARHQHHLQGCLDALSHYKPSKDLALAAEALRVARGHLTRLTGGGGTE
EILDIIFRDFCVGK
Download sequence
Identical sequences ENSPANP00000000676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]