SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000692 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000692
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 3.38e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000692   Gene: ENSPANG00000003109   Transcript: ENSPANT00000014740
Sequence length 390
Comment pep:known_by_projection chromosome:PapAnu2.0:14:6689101:6768457:-1 gene:ENSPANG00000003109 transcript:ENSPANT00000014740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFPPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSIPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQHPESPSLHSEEDEAEPSTVPGTPPPKKF
RSLFFGSILAPVCSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences A0A096MM69
ENSPANP00000000692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]