SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000787 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000787
Domain Number 1 Region: 25-480
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-83
Family ALDH-like 0.00000763
Further Details:      
 
Domain Number 2 Region: 500-762
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-44
Family ALDH-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000787   Gene: ENSPANG00000017969   Transcript: ENSPANT00000001170
Sequence length 795
Comment pep:known_by_projection chromosome:PapAnu2.0:19:42673219:42697807:1 gene:ENSPANG00000017969 transcript:ENSPANT00000001170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRAGPRAREIFTSLEYGPVPESHACALAWLDTQDRCLGHYVNGKWLKPEHRNSVPCQ
DPITGENLASCLQAQAEDVAAAVEAARTAFKSWSAHPGVVRAQHLVRLAKVIQKHQRLLW
TLESLVTGRAVREVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPMGVIGLILPPTFSFL
EMMWRICPALAVGCTVVALVPPASPTPLLLAQLSGELGPFPGILNVISGAASLVPVLASQ
PGIQKVAFCGALEEGRALRRTLAGECAELGLALGTESLLLLTDTADVDSAVEGVVDAAWS
DRGPGGLRLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREA
QSQGAQVFQAGDVPSEHPFYPPTLVSNLPPASPCARAEVPWPVVVASPFRTAKEALXPLP
ASHHLFSCVGRLYLPHRLQVGTVWINAHGLRDPSVPTGGCKESGCSWHGGPDGLYEYLRP
SGTPARLSCLSKNLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPGARSSRPI
QDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALERRKSTLA
SRLERQGVELKAAEAEVELSARRLRAWGARAQAQGHTLQVAGLRGPVLRLREPLGVLAVV
CPDEWPLLAFVSLLAPALAYGNTVVMVPSAACPLLALEVCQDMATLFPAGLANVVTGDRD
HLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWVNRGCLQAWDHEAEGAGPELG
LRSARTKALWLPMGD
Download sequence
Identical sequences ENSPANP00000000787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]