SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000962 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000962
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.17e-32
Family MaoC-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000962   Gene: ENSPANG00000022948   Transcript: ENSPANT00000000745
Sequence length 168
Comment pep:novel chromosome:PapAnu2.0:2:77001188:77001694:-1 gene:ENSPANG00000022948 transcript:ENSPANT00000000745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLISSHRFWWGGLRRTVCLNLPVLTLQHFQHMHIKVGDRAELRRAFTQTDVAAFSELT
GDVNPLHLNEDFAKHTKFGNTIVHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYI
GEVVLASAEVKKLKRFIAIIAVSCSVIESKKTVMEGWVKVMVPEALKS
Download sequence
Identical sequences ENSPANP00000000962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]