SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000997 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000997
Domain Number 1 Region: 6-175
Classification Level Classification E-value
Superfamily E set domains 1.08e-82
Family Arrestin/Vps26-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 177-393
Classification Level Classification E-value
Superfamily E set domains 9.8e-73
Family Arrestin/Vps26-like 0.00000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000997   Gene: ENSPANG00000011945   Transcript: ENSPANT00000028584
Sequence length 418
Comment pep:known_by_projection chromosome:PapAnu2.0:14:65107441:65198812:-1 gene:ENSPANG00000011945 transcript:ENSPANT00000028584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
LHREVPENQTPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR
Download sequence
Identical sequences A0A096MN07 A0A0D9QVC6 A0A2K5IPL6 A0A2K5N7Q6 A0A2K6MJ60 A0A2K6QDV8
ENSPANP00000000997 XP_008018354.1.81039 XP_010365103.1.97406 XP_011797411.1.43180 XP_011900199.1.92194 XP_017740755.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]