SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001007 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001007
Domain Number 1 Region: 384-492
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000534
Family YkuI C-terminal domain-like 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001007
Domain Number - Region: 210-289
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.087
Family Z-DNA binding domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001007   Gene: ENSPANG00000010808   Transcript: ENSPANT00000006633
Sequence length 944
Comment pep:known_by_projection chromosome:PapAnu2.0:1:66719089:66769067:1 gene:ENSPANG00000010808 transcript:ENSPANT00000006633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFCLDTDMVIIYLSAGITSKDSSEEDKKATLRVINEENSFLNNSVMILTYALMNDGVTG
LKELAFLRDLAEQNSGKYGVPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDE
AVFSLPFSDEMGDGLIMTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLI
DDKGYTLMHPSLTRPYLLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIIAVPVNSS
LSWHINKLRETGKEAYNVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYH
RLDLLGQPSACLHFKQLATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTR
LIANPGLKFSVRNEVMATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDK
AFDPTRRQWYLHAVANPGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGI
DFTLRYFYKVLMDLLPVCNQDGGNKIRCFIMEDRGYLVAHPTLIDPKGHAPVEQQHITHK
EPLVANDILNHPNFVKKNLCNSFSDRTVQRFYKFNTSLAGDLTNLVHGSHCSKYRLARIP
GTNAFVGIVNETCDSLAFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAE
NRNPSCEVHQEPVTYTAIDPGLQDALHQCVNSRCSQRLESGDCFGVLDCEWCMVDSDGKT
HLDKSYCAPQKECFGGIVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVL
VLAVYAYRHQIHRRSHQHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAA
VIERHAHSPERRRRYWGRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDEDLD
LDTPPQTAALLSHKFHHYRSHHPTLHHSHHLQAAVTVHTVDAEC
Download sequence
Identical sequences ENSPANP00000001007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]