SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001096 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001096
Domain Number 1 Region: 35-332
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.83e-108
Family Inorganic pyrophosphatase 0.0000000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001096   Gene: ENSPANG00000001031   Transcript: ENSPANT00000023604
Sequence length 334
Comment pep:known_by_projection chromosome:PapAnu2.0:5:96629712:96733406:-1 gene:ENSPANG00000001031 transcript:ENSPANT00000023604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGPRRAMALYHTEERGQPCSQNYRLFFKDVTGHYI
SPFHDIPLKVNSKEENGIPTKKARNDEYENLFNMIVEIPRWTNAKMEIATEEPLNPIKQY
VKDGKLRYVANIFPYKGYIWNYGTLPQTWEDPREKDKSTNCFGDNDPIDVCEIGSKILSC
GEVVHVKILGILALIDEGETDWKLIAINVNDPEASKFHDIDDVEKFKPGYLEATLNWFRL
YKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGGAINCTNVQISDSPF
RCTQEEARSLVESVLSSPNKENNEEEQVWHFLSK
Download sequence
Identical sequences A0A096MN84
ENSPANP00000001096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]