SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001100 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001100
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.08e-86
Family Integrin A (or I) domain 0.0000000484
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-23
Family Integrin domains 0.0004
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.31e-18
Family Integrin beta tail domain 0.00094
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000324
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-155
Classification Level Classification E-value
Superfamily Integrin domains 0.0000173
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001100
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001100   Gene: ENSPANG00000018923   Transcript: ENSPANT00000001627
Sequence length 788
Comment pep:known_by_projection chromosome:PapAnu2.0:12:21949299:22039151:-1 gene:ENSPANG00000018923 transcript:ENSPANT00000001627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTRPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEK
PVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTFFQHQKKCSHMKVGDTASFNVT
VNIPNCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCA
CHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGILCSGRGDCVCG
KCVCANPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEE
DFSKDGSVSCSLQGENECLITFLITTDNEGKSIIHSISEKDCPKPPNIPMIMLGVSLAIL
LIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLSTDG
Download sequence
Identical sequences A0A096MN88
ENSPANP00000001100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]