SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001188 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001188
Domain Number 1 Region: 221-262
Classification Level Classification E-value
Superfamily Ribosomal protein S8 0.000000017
Family Ribosomal protein S8 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001188   Gene: ENSPANG00000023574   Transcript: ENSPANT00000008474
Sequence length 270
Comment pep:novel chromosome:PapAnu2.0:20:16976692:16993609:-1 gene:ENSPANG00000023574 transcript:ENSPANT00000008474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEGRGGCREGRPTDISSLRGVPSCCGRRAGLGWRSHWKVPCGHRDGIPETMAEGDNRS
TNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLS
GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFT
LKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIATMVRMNVLADALKSINNAEKRGK
RQVLIRPCSKVIVRFLTVMMKHVWSDQPQI
Download sequence
Identical sequences ENSPANP00000001188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]