SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001251 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001251
Domain Number 1 Region: 20-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-57
Family Calnexin/calreticulin 0.0000648
Further Details:      
 
Domain Number 2 Region: 200-314
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.97e-46
Family P-domain of calnexin/calreticulin 0.000000604
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000001251
Domain Number - Region: 309-347
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0775
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001251   Gene: ENSPANG00000005597   Transcript: ENSPANT00000019999
Sequence length 358
Comment pep:known_by_projection chromosome:PapAnu2.0:19:11712098:11717693:1 gene:ENSPANG00000005597 transcript:ENSPANT00000019999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSVPLLLGLLGLAAAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDGGGYVKLFPNSLDQTD
MHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNT
YEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEH
IPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSP
DPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKD
Download sequence
Identical sequences ENSPANP00000001251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]