SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001311 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001311
Domain Number 1 Region: 111-152
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000875
Family POU-specific domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001311   Gene: ENSPANG00000015262   Transcript: ENSPANT00000017909
Sequence length 161
Comment pep:novel scaffold:PapAnu2.0:JH684964.1:62395:68038:-1 gene:ENSPANG00000015262 transcript:ENSPANT00000017909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLGDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQ
GGLETSQPEGEAGAGVESNSDGASPEPCTVPTGAVKLEKEKLEQNPEESQDIKALQKELE
QFAKLLKQKRITLGYTQADVGLTLGVLFGGFPSACSDHISL
Download sequence
Identical sequences ENSPANP00000001311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]