SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001589 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001589
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000154
Family VPS37 C-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001589   Gene: ENSPANG00000012312   Transcript: ENSPANT00000008278
Sequence length 352
Comment pep:known_by_projection chromosome:PapAnu2.0:14:12590343:12597393:1 gene:ENSPANG00000012312 transcript:ENSPANT00000008278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPAR
PVPQATPPVVEEQPQPPSAIPPYPLPYSPSPSLPVGPTAHGALPPAPFPVVSQPSFYSGP
LGPTYPAAQPGPRGYSWSPQRSTPPRSGYPGTPTGTSGPGYPLAGGRAPSPGYPQQSPYP
ATGGKPPYPIQPQLPSFPGQPQPSLPPQPPYPPGPAPPYGFPPPPGPAWPGY
Download sequence
Identical sequences A0A096MPD6
ENSPANP00000001589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]