SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001593 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001593
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily FKBP-like 5.11e-41
Family FKBP immunophilin/proline isomerase 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001593   Gene: ENSPANG00000012677   Transcript: ENSPANT00000009839
Sequence length 143
Comment pep:known_by_projection chromosome:PapAnu2.0:14:9846347:9851507:-1 gene:ENSPANG00000012677 transcript:ENSPANT00000009839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLSWVRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK
IPGSGATLVFEVELLKIERRSEL
Download sequence
Identical sequences ENSPANP00000001593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]