SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001715 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001715
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000126
Family LEM domain 0.0000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001715   Gene: ENSPANG00000012284   Transcript: ENSPANT00000020756
Sequence length 258
Comment pep:novel chromosome:PapAnu2.0:1:159956578:159957870:-1 gene:ENSPANG00000012284 transcript:ENSPANT00000020756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDYADLSNTELTALLRRYNIPHGPVVGSTRRLYEQKIFEYETQRRRLSPPGSSAASSYR
FSDLNSTSGDSDMYDLPKKEDALLYQSKGYNDDYYEESYFTTRTYGEPESAGPSRGFRQS
VTSLPDADTFHHQVRDDDLLSSSEEECKDRERPMYGRDSAYQSIAHYRPVSASRSSLDLS
YYPTSSSTSSMSSSSSSSSWLTRRAIRPENHAPGAGLGQDHQVPLWGQLLLFLVFVIVLF
FIYYFMQAEEFNNFNREE
Download sequence
Identical sequences ENSPANP00000001715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]