SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001837 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001837
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000641
Family Cgl1923-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001837   Gene: ENSPANG00000009225   Transcript: ENSPANT00000027139
Sequence length 264
Comment pep:known_by_projection chromosome:PapAnu2.0:18:1113371:1141643:-1 gene:ENSPANG00000009225 transcript:ENSPANT00000027139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESAPDLAGFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNP
YATAEGNSTELSINAEVYSLPSRKLVALQLRSIFIKYKSKPFCEKLLSWVKSSGCARVIV
LSSSHSYQRNDLQLRSTPFRYLLTPSIQRSVQNKIKSLNWQEMEKSRCIPEIDDSEFCIR
IPGGGITKTLYDESCSKEIQMAVLLKFVSEGDNIPDALGLAEYLNEWLQIIKPLSDDPTA
STSRWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences A0A2I3LY64 A0A2K5L517
XP_011944129.1.92194 ENSPANP00000001837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]