SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001995 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000001995
Domain Number - Region: 262-313
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0262
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001995   Gene: ENSPANG00000009365   Transcript: ENSPANT00000015454
Sequence length 520
Comment pep:known_by_projection chromosome:PapAnu2.0:19:39480480:39499745:1 gene:ENSPANG00000009365 transcript:ENSPANT00000015454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDAATLTMDQPAGLQVDYVFRGVEHAVRVMVSGQVLELEVEDRMTADQWRGEFDAGFIE
DLTHKTGNFKQFNIFCHMLESALTQSSESVTLDLLTYTDLESLRNRKMGGRPGSLAPRSA
QLNSKRYLILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLKEELGRLQGLDGQNTRD
TRESEIWRLREQVSRLASEKRELEVQLGRSREEALAGRAARQEAEALRGLVRGLELELRQ
ERGLGHRVAGRRGQDCRRLAKELEEAKASERSLRARLKTLTSELALYKKGRRTPPVQPSP
AREDRASSYRERSTSRGRGAARSSSRESGRGSRGRGRPARPSPSPTGGRALRFDPTAFVK
AKERKQREIKMKQQQRNRLGSGGSGDGPSVSWSRQTRAPAVVTGRGDAPNRSRNRSSSVD
SFRSRCSSASSCSDLEDFSESLSRGGHRRRGKPPGPTPWSGSNTKSTPVERSHHQKSLGN
SGGWVPIKEYSSDHQAADMAEIDARLKALQEYMNRLDMRS
Download sequence
Identical sequences ENSPANP00000001995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]