SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002041 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002041
Domain Number 1 Region: 81-139
Classification Level Classification E-value
Superfamily Kringle-like 2.86e-19
Family Fibronectin type II module 0.0031
Further Details:      
 
Domain Number 2 Region: 200-245
Classification Level Classification E-value
Superfamily Kringle-like 5.42e-16
Family Fibronectin type II module 0.0022
Further Details:      
 
Domain Number 3 Region: 140-191
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000999
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 4 Region: 49-93
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000628
Family Fibronectin type II module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002041   Gene: ENSPANG00000009363   Transcript: ENSPANT00000022225
Sequence length 245
Comment pep:known_by_projection chromosome:PapAnu2.0:19:41255887:41278337:1 gene:ENSPANG00000009363 transcript:ENSPANT00000022225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRWSSYLLGWTTFLLCSYESSGEIPNLGSLSTHETTELQLNILYRMHEECVFPFTYKGS
VYFTCTKIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSL
WCSVTSVFDEKQQWKFCETNEYGGNSLSKPCIFPSIYRNNVVSDCLEDESNKLWCPTTEN
MDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDH
TWVYC
Download sequence
Identical sequences ENSPANP00000002041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]