SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002053 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002053
Domain Number 1 Region: 165-254
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 8.76e-19
Family Translation initiation factor IF3, C-terminal domain 0.0036
Further Details:      
 
Domain Number 2 Region: 87-157
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.00000000981
Family Translation initiation factor IF3, N-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002053   Gene: ENSPANG00000005047   Transcript: ENSPANT00000011186
Sequence length 287
Comment pep:known_by_projection chromosome:PapAnu2.0:17:6750839:6755923:-1 gene:ENSPANG00000005047 transcript:ENSPANT00000011186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSSYYVLRMAALFLKRLTLQTVKFENSCVRCFGKHIVQKTAPAQSFPIASAPRLSFLIH
AEAFSTVEDTQNEGKKKKKSQTAFGNVGRKISQRIIHLFDEKGNDMGNMHRADVIRLMDE
RDLRLVQRNASTEPAEYQLMTGMQILQERQRLREMKKASPKTGPTVTKELTFSSNIGQHD
LDTKTKQIQQWIKKERQVRITIKKGKHVDVSQNKMEEMFHQLLQTMPGMATFLSRPQAVQ
GGKALMCVLRPLSKNEEKAYGETQKTQKRDTLNQDQGNDKESNVLHQ
Download sequence
Identical sequences A0A096MQM0
ENSPANP00000002053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]