SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002094 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002094
Domain Number 1 Region: 65-116
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000147
Family LEM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 311-380,408-458
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000246
Family Ankyrin repeat 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002094
Domain Number - Region: 215-250
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00889
Family N-terminal domain of RNase HI 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002094   Gene: ENSPANG00000003835   Transcript: ENSPANT00000010887
Sequence length 939
Comment pep:known_by_projection chromosome:PapAnu2.0:11:131797144:131835744:-1 gene:ENSPANG00000003835 transcript:ENSPANT00000010887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWPRLAAAEWAALAWELLGASVLLIAVRWLVRRLGPRPGGLGRSGTPVPPPPAAAAPAP
GEMTMDAVLARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLPSF
DHHEAGATALSQDTQRILKSAEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTRSVPP
SAVDTYGTAVTASKEPPLYYGVCPVYEDVPARNERIHVYENKKEALQAVKMIKGSRFKAF
STREDAEKFARGICDYFPSPSRPSLPLSPVKTAPLFSNDGLKDGLCLSESETVNKERANS
YKNPRTQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAK
ENQASICRLTLDVLENPDFMRLMYPDDDEAMLQKRIRYVVDLYLNTPDKMGYDTPLHFAC
KFGSADVVNVLSSHHLIVKNPRNKYDKTPEDVICERSKNKSVELKERIREYLKGHYYVPL
LRAEDTSSPVIGELWSPDQTAEASHVSRHGGSPRDPVLTLRAFAGPLSPAKAEDFRKLWK
TPPREKAGFLHHVKKSDPERGFERVGRELAHELGYPWVEYWEFLGCFVDLSSQEGLQRLE
EYLTQQEIGKKAQQETGEREASCGDKATMSGSNSISVRAFLDEDDMSLEEIKNRQNAARN
NSPPTVGAFGYARCSIFPLEQEADLIEAAEPGGPHSSRNGLCHPLSHSRTLVGKRPKAPR
GEEAHLPPVSDLTVEFDKLNLQNVGSSVSKTPDENTKTKDKILTSRIDAVERDLLEPPPP
ADQLGPGRRRTESEMSARIANMSLSPSSPGHEGQLEVTRESARRLFLFGEEPSKLDQDVL
AALECADVDPHQFPAVHRWKTAVLCYSPSDRQSWPSPAVKGKFKSRLPDLSGPHSYSPGR
NSAAGSNPGKPGPGSPGRYSPAHGNQLRRMARLAELAAL
Download sequence
Identical sequences A0A096MQR0
ENSPANP00000002094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]