SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002143 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002143
Domain Number 1 Region: 362-464
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-16
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 570-734
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000118
Family Tetraviridae-like VP 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002143   Gene: ENSPANG00000016773   Transcript: ENSPANT00000028091
Sequence length 790
Comment pep:known_by_projection chromosome:PapAnu2.0:1:124586643:124637169:-1 gene:ENSPANG00000016773 transcript:ENSPANT00000028091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGISCTSTEMTSDVPSLGPAIASGNPGPGIQGGGAIVQRAVKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQILAQISRHSNPTQGATPTWTPTTRSGFSAQQVVTQATAKT
RTSQFGVGNFQTPPSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPSAQQPGQPEVFQQEMLSMLGDQSNSYNNEEFP
DLTMFPPFSE
Download sequence
Identical sequences ENSPANP00000002143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]