SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002167 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000002167
Domain Number - Region: 187-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000138
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number - Region: 237-282
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0288
Family RILP dimerisation region 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002167   Gene: ENSPANG00000014288   Transcript: ENSPANT00000019898
Sequence length 866
Comment pep:known_by_projection chromosome:PapAnu2.0:17:72973330:73035687:-1 gene:ENSPANG00000014288 transcript:ENSPANT00000019898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEAADWLSSMPFQKHVYYPLTSGPEGPDVAVAAAAGAASMACAPPSAALGPQPFFQFR
PRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVLLKLI
RLAQFTIEYLLHSQEFLTSQLHTLEERLRLSHCEGEQSKKLLTKQVGEIKMLKEECKRRK
KIISTQQLMIEAKANYYQCHFCDKAFMNQAFLQSHIQRRHTEENSRFEYQKNAQIEKLRS
EIVVLKEELQLTRSELEAAHHASAVRFSKEYEMQKTKEEDFLKLFDKWKEEEKEKLVDEM
EKVKEMFMKEFKELTSKNSALEYQLSEIQKSNMQIKSNIGTLKDAHEFKEDRSPYPQDFH
NVMQLLDSQESKWTARVQAIHQEHKKEKDRLLSHIEKLRTSMIDDLNASNVFYKKRIEEL
GQRLQEQNELIITQRQQIKDFTCNPVNSISEPKGNPLAWQAFESQPAVPAVPMNAPALHT
SETKSSLPMAQEQAFSSHILEPIEELSEEEKGRENEQKLNNNKMHLRKALKSNSSLTKGL
RTMVEQNLMEKLETLGINADVHGISSDQLHRVLKSVESERHKQEREIPNFHQIREFLEHQ
VSCKIEEKALLSSDKYSVSQMDTLSTGEVPKMIQLPPKNRQLIRQKAVSTDRTSVSKIKK
NIMEDHFPRKFSTITTPPFSSEEEQEDDDLIRAYASSGPLPVPPSQNKGSFGKNAVKSDA
DGTEGSEIEDTDDSPKPTGATIKTPTEKVEKMFSHRKNVNKPVGGTNVPEMFIKKEELQE
LKCADVEDEDWDISSLEEEISLGKKSGKEQKEPPPVKNEPHFAHVLNAWGAFNPKGPKGE
GLQENESSTLKSSLVTVTDWSDSSDV
Download sequence
Identical sequences A0A096NYW2
ENSPANP00000002167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]