SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002280 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002280
Domain Number 1 Region: 555-780
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-60
Family Eukaryotic proteases 0.00000000292
Further Details:      
 
Domain Number 2 Region: 175-269
Classification Level Classification E-value
Superfamily Kringle-like 1.45e-35
Family Kringle modules 0.00000541
Further Details:      
 
Domain Number 3 Region: 270-353
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 362-446
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 440-537
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-29
Family Kringle modules 0.00039
Further Details:      
 
Domain Number 6 Region: 96-185
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 6.28e-23
Family Hairpin loop containing domain 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002280   Gene: ENSPANG00000016786   Transcript: ENSPANT00000005031
Sequence length 788
Comment pep:known_by_projection chromosome:PapAnu2.0:3:120224898:120292065:1 gene:ENSPANG00000016786 transcript:ENSPANT00000005031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCLCLDLAIGLSLAPPCLTRIGATGIWSSSFQIEAGLRPGDLFFASPPEGSASPSSST
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNNGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCAENTVNDTDVPM
ETTECIQGQGEGYRGTANTIWNGIPCQRWDSQYPHKHDMTPENFKCKDLRENYCRNPDGS
ESPWCFTTDPNIRVGYCSQIPNCDMSNGQDCYRGNGKNYMGNLSQTRSGLTCSMWNKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVNTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAG
AEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences A0A096MR85
ENSPANP00000002280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]