SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002281 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002281
Domain Number 1 Region: 587-665,882-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.13e-63
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 
Domain Number 2 Region: 104-266,304-353
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.44e-16
Family Quinoprotein alcohol dehydrogenase-like 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002281
Domain Number - Region: 461-524
Classification Level Classification E-value
Superfamily TM1622-like 0.0981
Family TM1622-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002281   Gene: ENSPANG00000026451   Transcript: ENSPANT00000019767
Sequence length 1115
Comment pep:known_by_projection chromosome:PapAnu2.0:13:86537399:86612016:-1 gene:ENSPANG00000026451 transcript:ENSPANT00000019767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERATRPGLLVLALLLPLLLGLAAWTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVPA
AGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDEAELRPRSRSLVIISTLDGRIAALDPE
NHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGGLFQWDRDRESMETVPFTVESL
LESSYKFGDDVVLVGGKSLTTYGLSACSGKVRYICSALGCRQWDSDEMEQEEDILLLQRT
QKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEEQ
EAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTSY
TSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPTSPKALESVNNEN
AIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGYY
LPYYKRERNKRSTQITVRFLDNPNYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIVR
RLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYVSRYLTDFEPIQCLGR
GGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLEA
PPEKWQEKMDEIWLKDASTDWPLSSPSPMDAPSVKIRRMDPFSTKEHVEIIAPSPERSRS
FSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGNDE
GHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAFK
PTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWMN
GRCTIEERERSMCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTA
MDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPF
STQMERVRTLTDVRNLKFPPLFTQKYPCEYMMVQDMLSPSPMERPEATNIIENAVFEDLD
FPGKTVLRQRSRSLSSSGTKHSRQSNNSHSSLPSN
Download sequence
Identical sequences A0A096MR86
ENSPANP00000002281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]