SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002298 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002298
Domain Number 1 Region: 415-529,649-795
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-64
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 22-403
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-62
Family L-arabinose binding protein-like 0.0063
Further Details:      
 
Domain Number 3 Region: 546-648
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000196
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002298   Gene: ENSPANG00000003734   Transcript: ENSPANT00000017408
Sequence length 902
Comment pep:known_by_projection chromosome:PapAnu2.0:14:95012097:95395583:1 gene:ENSPANG00000003734 transcript:ENSPANT00000017408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHAGTAIRQSSGLAVIASD
LP
Download sequence
Identical sequences A0A096MR99 A0A2K5JWP1 A0A2K5N3Y1 A0A2K5YF63 A0A2K6DC72 A0A2K6JQF8 G7NBS5 G7PNL9
ENSMMUP00000006497 ENSPANP00000002298 ENSMMUP00000014398 XP_005579557.1.63531 XP_008018892.1.81039 XP_008018894.1.81039 XP_008018895.1.81039 XP_011759827.1.29376 XP_011782039.1.43180 XP_011782041.1.43180 XP_011857774.1.47321 XP_011857775.1.47321 XP_011921926.1.92194 XP_014971068.1.72884 9544.ENSMMUP00000014398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]