SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002323 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002323
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily FKBP-like 6.08e-28
Family FKBP immunophilin/proline isomerase 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002323   Gene: ENSPANG00000011547   Transcript: ENSPANT00000018543
Sequence length 138
Comment pep:novel scaffold:PapAnu2.0:AHZZ01162090.1:973:1386:1 gene:ENSPANG00000011547 transcript:ENSPANT00000018543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQQQASKMPPKGQSGSGKAGKGGAASGSDSADKKAQGPKGAGNAVKVRHILCEKHGKIME
AMEKLKSGMRFNEVASQYSEDKARQGGDLGWMTRGSMVGPFQEPAFALPVSGMDKPVFTD
PPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences ENSPANP00000002323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]