SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002684 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002684
Domain Number 1 Region: 285-588
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-64
Family Kelch motif 0.0000525
Further Details:      
 
Domain Number 2 Region: 9-125
Classification Level Classification E-value
Superfamily POZ domain 1.41e-31
Family BTB/POZ domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002684   Gene: ENSPANG00000010573   Transcript: ENSPANT00000011831
Sequence length 604
Comment pep:known_by_projection chromosome:PapAnu2.0:X:21287709:21330119:-1 gene:ENSPANG00000010573 transcript:ENSPANT00000011831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGDVEGFCSSIHDTSVSAGFRALYEEGLLLDVTLVIEDHQFQAHKALLATQSDYFRIMF
TADMRERDQDKIHLKGLTATGFSHVLQFMYYGTIELSMNTVHEILQAAMYVQLIEVVKFC
CSFLLAKICLENCAEIMRLLDDFGVNIEGVREKLDAFLLDNFVPLMSRPDFLSYLSFEKL
MSYLDNDHLSRFPEIELYEAVQSWLRHDRRRWRHTDTIIQNIRFCLMTPTSVFEKVKTSE
FYRYSRQLRYEVDQALNYFQNVHQQPLLDMKSSRIRSAKPQTTVFRGMIGHSMVNSKILL
LKKPRVWWELEGPQVPLRPDCLAIVNNFVFLLGGEELGPDGEFHASSKVFRYDPRQNSWL
QMADMSVPRSEFAVGVIGKFIYAVAGRTRDETFYSTERYDITNDKWEFVDPYPVNKYGHE
GTVLNNKLFITGGITSSSTSKQVCVFDPSKEGTIEQRTRRTQVVTNCWENKSKMNYARCF
HKMISYNGKLYVFGGVCVILRASFESQGCPSTEVYNPETDQWTILASMPIGRSGHGVTVL
DKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEV
RRCN
Download sequence
Identical sequences A0A096MSC1 A0A0D9RPF9 A0A2K5IU23 A0A2K5LG49 A0A2K5WJD2 A0A2K5XIE1 A0A2K6AQF5 A0A2K6P4D5 F6RME8 G1RG82 G3S6V6 H2PV50 K7BHE3
NP_001244541.1.72884 XP_003261202.1.23891 XP_007989500.1.81039 XP_007989501.1.81039 XP_008971228.1.60992 XP_008971229.1.60992 XP_009232943.1.23681 XP_010387670.1.97406 XP_011733664.1.29376 XP_011733665.1.29376 XP_011790509.1.43180 XP_011843392.1.47321 XP_011891022.1.92194 XP_011891023.1.92194 XP_014982577.1.72884 XP_014982578.1.72884 XP_015299094.1.63531 XP_016799310.1.37143 XP_016799311.1.37143 XP_018875389.1.27298 ENSMMUP00000018201 ENSMMUP00000018201 ENSGGOP00000018110 ENSPPYP00000022594 9544.ENSMMUP00000018201 9600.ENSPPYP00000022594 ENSPANP00000002684 ENSNLEP00000012232 ENSPPYP00000022594 ENSNLEP00000012232 ENSGGOP00000023813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]