SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002692 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002692
Domain Number 1 Region: 4-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 2.09e-117
Family 2-methylcitrate dehydratase PrpD 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002692   Gene: ENSPANG00000010191   Transcript: ENSPANT00000008904
Sequence length 481
Comment pep:known_by_projection chromosome:PapAnu2.0:17:54660099:54669557:1 gene:ENSPANG00000010191 transcript:ENSPANT00000008904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLKSITESFATTIHGLKAGHLTDRVIQRSKRMILDTLGAGFLGTSTEVFHKASQYSKIY
SSNITSTVWGRPDIRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALAEALP
RSPKFSGLDLLLAFNVGIEVQGRLLHFAKEAKDIPKRFHPPSVVGTLGSAATASKFLGLS
STKCQEALAIAVSHAGAPMANAATQTKPLHIGNAAKHGIEAAFLAMLGLQGNKQVLDLEA
GFGAFYANYSPKVLPNLDSYSWLLDQQDVAFKRFPAHLCTHWVADAAASVRKNLVAETAL
LPIDYIKRIVLRIPNVQYVNRSFPDSEHEARHSFQYVACAMLLDGSIAVPAFHECQINRP
QVRELLSKVELEYPPDNLPSFNTLYCEISVTLKDGATFTHRSDTFYGHWRKPLSQEDLEE
KFRANVSNMLPSDTVESLIKIVENLEDLEDCSVLTTLLKGPSPPEMASNSSAYNNSITNL
S
Download sequence
Identical sequences A0A096MSC9
ENSPANP00000002692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]