SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002774 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002774
Domain Number 1 Region: 66-213
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-41
Family C-type lectin domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002774   Gene: ENSPANG00000006039   Transcript: ENSPANT00000016936
Sequence length 217
Comment pep:known_by_projection chromosome:PapAnu2.0:11:8325358:8334076:1 gene:ENSPANG00000006039 transcript:ENSPANT00000016936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLEKPQSKLLVEGGVHSQWIPWVIATVFISLLGVCFIASCLVTHHNFSRCKRGTGVHKL
EHHEKLKCIKEKSELKSAEGSTWSCCPVGWRTLQSNCYFPLTDNKTWAESERNCSGMGAH
LTTISTEAEQNFITQFLDRRFSYFLGLRDENAKGQWCWVDQTPFNPRTVFWHDNEPNNYQ
GENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Download sequence
Identical sequences ENSPANP00000002774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]