SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002866 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002866
Domain Number 1 Region: 336-434
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.19e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000002866
Domain Number - Region: 187-241
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00451
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002866   Gene: ENSPANG00000008425   Transcript: ENSPANT00000017087
Sequence length 1258
Comment pep:known_by_projection chromosome:PapAnu2.0:12:100040552:100077079:-1 gene:ENSPANG00000008425 transcript:ENSPANT00000017087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGWYFGLPPANQSHPSLLPVSVYPLSSCPLQEDVDMSSGSSGHETNENCSTGRDSQGSDC
DDSGKELGMLVEPPDAHQSPDAFSLMITKSEHNPSTSGCSSDQSSKVDTHKELIKTLKEL
KVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGSDVPSYTVEEM
ESVTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHYKRDAFSDAKFVEFLAPHDVGV
FHSFTSPYKLPLWSVCSGADSFTQECMEEKSFFCRVSVEKSHENEIRYHPFRMTPYLVKV
REQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLP
QDLIETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRTRNGEYITLDTSWSSFI
NPWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSVQELTEQIHRLLLQPVPHSG
SSGYGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEIYKNGNKTKNRSLYSLESGEQKK
NSVTEMQTNPPAEMKAVPAVEKDSLGASFPEELACKDQPTCSYQQISCLDSVIRYLESCN
EAATLKRKCEFPANVPTLRSSDKRKATVSPGPHAGEAEPPSRVNSHTGVSTHLTSLALPG
KAESVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAVSGPESLDCLVGPALACGLSQEKE
PFKKLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTLAAP
GLRNTSGIDSPWRKPGKNRKLKSKRVKPRDSSESTGSGGPLPARPPLVGLNTTAWSPSDT
SQSSCPAVPFPAPVPAYSLPVFPAPGTVAATPAPPHASFAVPAVPVDLQHQFAVQPPPFP
APLAPVMAFMLPGYSFPSGTPNLPQAFFPSQPQFPSHPTITSEMASASQPEFPSRTSIPR
QPCACPGTRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAV
VGADCKPGTSRDQQPKAPLTRDEPSDTQNSDVLSTSSGLLNLLLNEDLCSASGSAASESL
GSGSLGCDTSPSRAGSSDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIW
LLMADADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTG
GLPAAIDVAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQT
Download sequence
Identical sequences ENSPANP00000002866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]