SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002953 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002953
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.84e-97
Family Carbonic anhydrase 0.0000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002953   Gene: ENSPANG00000020684   Transcript: ENSPANT00000008729
Sequence length 262
Comment pep:known_by_projection chromosome:PapAnu2.0:8:81007864:81046007:1 gene:ENSPANG00000020684 transcript:ENSPANT00000008729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTQEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTEDKSVLRGGPLAGSYRLRQFHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDILDSIKEKGKQTRFTNF
DPLSLLPPSWDYWTYPGSLTVPPLLESVIWIVLKQPINVSSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFR
Download sequence
Identical sequences A0A096MT29 A0A2K5P0Z4 A0A2K5ZRE7 A0A2K6BTX3 G7MZP0
ENSPANP00000002953 XP_011731823.1.29376 XP_011851033.1.47321 XP_011887205.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]