SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003084 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003084
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.58e-24
Family Ribosomal L11/L12e N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.88e-17
Family Ribosomal protein L11, C-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003084   Gene: ENSPANG00000018675   Transcript: ENSPANT00000009503
Sequence length 192
Comment pep:known_by_projection chromosome:PapAnu2.0:14:7668860:7673432:1 gene:ENSPANG00000018675 transcript:ENSPANT00000009503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRTTRGLRKPEVGGVIRTIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
ACIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKE
ADLAAQEEAAKK
Download sequence
Identical sequences A0A096MTF3
ENSPANP00000003084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]